PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G104500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRF
Protein Properties Length: 602aa    MW: 62484.5 Da    PI: 6.9816
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G104500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.89.4e-24226269245
                   WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                            epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Sobic.001G104500.1.p 226 LEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 269
                           69***************************************986 PP

2QLQ57.15.3e-20158194137
                   QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                           ++FT++Q+ +L++Q+l+yKyLaan P+P+ Ll +i++
  Sobic.001G104500.1.p 158 GPFTPSQWIELEHQALIYKYLAANSPIPHSLLIPIRR 194
                           59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.2E-11158194IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-14159193IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.975159194IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.65225269IPR014977WRC domain
PfamPF088795.1E-20227268IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MDLMGGVVMD AGGGGAAELG LLGGGGSSSR LLKHGRGNAA AGGEDHGWGG GVGGGRAKQA  60
RTATASVVAG DVVEAAKAAA APFLLGSCSP GHGGEQMLSF SSATAAASSC ASTAAVAAAV  120
AADGGAMPLY YGTPASCSGL SSVSLSTSMQ GAMARVRGPF TPSQWIELEH QALIYKYLAA  180
NSPIPHSLLI PIRRSLASSP YPPSYFGTST LGWGSFQLGY SGNADLEPGR CRRTDGKKWR  240
CSRDAVADQK YCERHMNRGR HRSRKHVEGQ PGHAAKAMSA VVAAAATQPA ALAGAGATAA  300
GLTVNQHQQP AKSYATGAAD PCSLQYNREL VNKQNESENM QDSDNLSMLT SMTTGNTGSV  360
FPFSKQNNPF EVTSSRPEFG LVSSDSLMSS PHSSLENVNL LSSQSLNEHQ SSATLQHFVD  420
WPRTPAQGGL SWPEAEDMQA QRSQLSISAP MASSELSSAS TSPIHEKLML SPLKLSREYS  480
PTGLSIAANR DEVSQLEATW ATMFRDSSMG GPLGEVLNKN GNVEAKNCLS APLNLLTDYW  540
DSSHGMESSP VGVLQKTTFG SVSSSTGSSP RIENHGAYDG ISNLRDDLGS IVVSHPSIRF  600
V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0670850.0BT067085.1 Zea mays full-length cDNA clone ZM_BFb0185D09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466526.10.0hypothetical protein SORBIDRAFT_01g009330
SwissprotQ6AWY30.0GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLC5WM010.0C5WM01_SORBI; Putative uncharacterized protein Sb01g009330
STRINGSb01g009330.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Representative plantOGRP33571226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.17e-49growth-regulating factor 2